CTSK, Recombinant, Human, aa115-329, His-Tag (Cathepsin K)

Artikelnummer: USB-372913
Artikelname: CTSK, Recombinant, Human, aa115-329, His-Tag (Cathepsin K)
Artikelnummer: USB-372913
Hersteller Artikelnummer: 372913
Alternativnummer: USB-372913-20,USB-372913-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Closely involved in osteoclastic bone resorption and may participate partially in the disorder of bone remodeling. Displays potent endoprotease activity against fibrinogen at acid pH. May play an important role in Extracellular domain matrix degradation. Source: Recombinant protein corresponding to aa115-329 from human Cathepsin K, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~25.5kD Amino Acid Sequence: APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASFPKM Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 25.5
UniProt: P43235
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.