CXCL10, Recombinant, Human, aa22-98, His-Tag (C-X-C Motif Chemokine 10)

Artikelnummer: USB-372921
Artikelname: CXCL10, Recombinant, Human, aa22-98, His-Tag (C-X-C Motif Chemokine 10)
Artikelnummer: USB-372921
Hersteller Artikelnummer: 372921
Alternativnummer: USB-372921-20,USB-372921-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Chemotactic for monocytes and T-lymphocytes. Binds to CXCR3. Source: Recombinant protein corresponding to aa22-98 from human CXCL10, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~10.65kD Amino Acid Sequence: VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 10.65
UniProt: P02778
Reinheit: 85% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.