CXCL3, Recombinant, Human, aa35-107, His-Tag (C-X-C Motif Chemokine 3)

Artikelnummer: USB-372930
Artikelname: CXCL3, Recombinant, Human, aa35-107, His-Tag (C-X-C Motif Chemokine 3)
Artikelnummer: USB-372930
Hersteller Artikelnummer: 372930
Alternativnummer: USB-372930-20,USB-372930-100,USB-372930-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Ligand for CXCR2. Has chemotactic activity for neutrophils. May play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. In vitro, the processed form GRO-gamma(5-73) shows a fivefold higher chemotactic activity for neutrophilic granulocytes. Source: Recombinant protein corresponding to aa35-107 from human CXCL3, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.9kD Amino Acid Sequence: ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 11.9
UniProt: P19876
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.