Cyanovirin-N Homolog, Recombinant, Ceratopteris Richardii, aa28-142, His-SUMO-Tag

Artikelnummer: USB-372940
Artikelname: Cyanovirin-N Homolog, Recombinant, Ceratopteris Richardii, aa28-142, His-SUMO-Tag
Artikelnummer: USB-372940
Hersteller Artikelnummer: 372940
Alternativnummer: USB-372940-20,USB-372940-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Mannose-binding lectin. Source: Recombinant protein corresponding to aa28-142 from ceratopteris richardii Cyanovirin-N homolog, fused to 10xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.9kD Amino Acid Sequence: QCNFANSCTGVELYGYILRGDCINEDGHPHATSINLNYYIGNDNGRLEYPGESFGSSCVKTALNDGHTLTASCKGADGQYHDSSMDLNYVVGNSYGYMEPCRASNADHVLKSSSE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.9
UniProt: P86326
Reinheit: ~90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.