CYBB, Recombinant, Human, aa283-570, His-Tag (Cytochrome b-245 Heavy Chain)

Produktübersicht

• Artikelname: CYBB, Recombinant, Human, aa283-570, His-Tag (Cytochrome b-245 Heavy Chain)
• Artikelnummer: USB-372942
• Hersteller Artikelnummer: 372942
• Alternativnummer: USB-372942-20,USB-372942-100,USB-372942-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from Cytoplasmic domain NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H+ currents of resting phagocytes. It participates in the regulation of cellular pH and is blocked by zinc. Source: Partial recombinant protein corresponding to aa283-570 from human CYBB, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.2kD Amino Acid Sequence: ERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASILKSVWYKYCNNATNLKLKKIYFYWLCRDTHAFEWFADLLQLLESQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPEALAETLSKQSISNSESGPRGVHFIFNKENF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 37.2
• UniProt: P04839
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.