CYS4, Recombinant, Saccharomyces Cerevisiae, aa1-345, His-Tag (Cystathionine Beta-Synthase)

Artikelnummer: USB-372963
Artikelname: CYS4, Recombinant, Saccharomyces Cerevisiae, aa1-345, His-Tag (Cystathionine Beta-Synthase)
Artikelnummer: USB-372963
Hersteller Artikelnummer: 372963
Alternativnummer: USB-372963-10,USB-372963-50,USB-372963-100,USB-372963-200
Hersteller: US Biological
Kategorie: Molekularbiologie
Partial recombinant protein corresponding to aa1-345 from saccharomyces cerevisiae CYS4, fused to 6X His-Tag at N-terminal, expressed in Yeast. Accession/Uniprot: P32582 Molecular Weight: ~39.92kD Amino Acid Sequence: MTKSEQQADSRHNVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKDRIAKSMVEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKKLEKEIPGAVILDQYNNMMNPEAHYFGTGREIQRQLEDLNLFDNLRAVVAGAGTGGTISGISKYLKEQNDKIQIVGADPFGSILAQPENLNKTDITDYKVEGIGYDFVPQVLDRKLIDVWYKTDDKPSFKYARQLISNEGVLVGGSSGSAFTAVVKYCEDHPELTEDDVIVAIFPDSIRSYLTKFVDDEWLKKNNLWDDDVL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 39.92
UniProt: P32582
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.