Cytomegalovirus Envelope Glycoprotein L, Recombinant, Human, aa31-278, His-Tag (GL)

Artikelnummer: USB-372974
Artikelname: Cytomegalovirus Envelope Glycoprotein L, Recombinant, Human, aa31-278, His-Tag (GL)
Artikelnummer: USB-372974
Hersteller Artikelnummer: 372974
Alternativnummer: USB-372974-20,USB-372974-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. Source: Recombinant protein corresponding to aa31-278 from human gL, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~29.5kD Amino Acid Sequence: AAVSVAPTAAEKVPAECPELTRRCLLGEVFEGDKYESWLRPLVNVTGRDGPLSQLIRYRPVTPEAANSVLLDEAFLDTLALLYNNPDQLRALLTLLSSDTAPRWMTVMRGYSECGDGSPAVYTCVDDLCRGYDLTRLSYGRSIFTEHVLGFELVPPSLFNVVVAIRNEATRTNRAVRLPVSTAAAPEGITLFYGLYNAVKEFCLRHQLDPPLLRHLDKYYAGLPPELKQTRVNLPAHSRYGPQAVDAR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 29.5
UniProt: F5HCH8
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.