DAP, Recombinant, Human, aa2-102, GST-Tag (Death-Associated Protein 1)

Artikelnummer: USB-372986
Artikelname: DAP, Recombinant, Human, aa2-102, GST-Tag (Death-Associated Protein 1)
Artikelnummer: USB-372986
Hersteller Artikelnummer: 372986
Alternativnummer: USB-372986-20,USB-372986-100,USB-372986-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Negative regulator of autophagy. Involved in mediating interferon-gamma-induced cell death. Source: Recombinant protein corresponding to aa2-102 from human DAP1, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~38.0kD Amino Acid Sequence: SSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQPRK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 38
UniProt: P51397
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.