DBNDD2, Recombinant, Human, aa1-161, His-SUMO-Tag (Dysbindin Domain-containing Protein 2)

Produktübersicht

• Artikelname: DBNDD2, Recombinant, Human, aa1-161, His-SUMO-Tag (Dysbindin Domain-containing Protein 2)
• Artikelnummer: USB-372991
• Hersteller Artikelnummer: 372991
• Alternativnummer: USB-372991-20,USB-372991-100,USB-372991-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

May modulate the activity of casein kinase-1. Inhibits CSNK1D autophosphorylation (in vitro). Source: Recombinant protein corresponding to aa1-161 from human DBNDD2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~33.5kD Amino Acid Sequence: MDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVELIDLGDPDAADVFLPCEDPPPTPQSSGMDNHLEELSLPVPTSDRTTSRTSSSSSSDSSTNLHSPNPSDDGADTPLAQSDEEEERGDGGAEPGACS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 33.5
• UniProt: Q9BQY9
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.