DDP1, Recombinant, Saccharomyces Cerevisiae, aa2-188, His-SUMO-Tag (Diphosphoinositol Polyphosphate Phosphohydrolase DDP1)

Artikelnummer: USB-373010
Artikelname: DDP1, Recombinant, Saccharomyces Cerevisiae, aa2-188, His-SUMO-Tag (Diphosphoinositol Polyphosphate Phosphohydrolase DDP1)
Artikelnummer: USB-373010
Hersteller Artikelnummer: 373010
Alternativnummer: USB-373010-20,USB-373010-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May eliminate potentially toxic dinucleoside polyphosphates during sporulation. Most active against diadenosine 5,5-P1,P6-hexaphosphate (Ap6A). Can also hydrolyze diadenosine 5,5-P1,P5-pentaphosphate (Ap5A), adenosine 5-pentaphosphate, and adenosine 5-tetraphosphate are also substrates, but not diadenosine 5,5-P1,P4-tetraphosphate (Ap4A) or other dinucleotides, mononucleotides, nucleotide sugars, or nucleotide alcohols. Also cleaves a beta-phosphate from the diphosphate groups in PP-InsP5 (diphosphoinositol pentakisphosphate) and [PP]2-InsP4 (bisdiphosphoinositol tetrakisphosphate). Source: Recombinant protein corresponding to aa2-188 from saccharomyces cerevisiae DDP1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.4kD Amino Acid Sequence: GKTADNHGPVRSETAREGRENQVYSPVTGARLVAGCICLTPDKKQVLMITSSAHKKRWIVPKGGVEKDEPNYETTAQRETWEEAGCIGKIVANLGTVEDMRPPKDWNKDIKQFENSRKDSEVAKHPPRTEFHFYELEIENLLDKFPECHKRHRKLYSYTEAKQNLIDAKRPELLEALNRSAIIKDDK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 37.4
UniProt: Q99321
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.