Decorin, Recombinant, Mouse, aa35-35, His-SUMO-Tag (Dcn)

Artikelnummer: USB-373016
Artikelname: Decorin, Recombinant, Mouse, aa35-35, His-SUMO-Tag (Dcn)
Artikelnummer: USB-373016
Hersteller Artikelnummer: 373016
Alternativnummer: USB-373016-20,USB-373016-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May affect the rate of fibrils formation. Source: Partial recombinant protein corresponding to aa35-354 from mouse Decorin, fused to 6xHis-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.9kD Amino Acid Sequence: GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 51.9
UniProt: P28654
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.