Peptide Deformylase, Recombinant, E. coli, aa2-169, His-SUMO-Tag (Def)

Artikelnummer: USB-373018
Artikelname: Peptide Deformylase, Recombinant, E. coli, aa2-169, His-SUMO-Tag (Def)
Artikelnummer: USB-373018
Hersteller Artikelnummer: 373018
Alternativnummer: USB-373018-20,USB-373018-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions. Source: Recombinant protein corresponding to aa2-169 from E. coli Peptide Deformylase, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.2kD Amino Acid Sequence: SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Molekulargewicht: 35.2
UniProt: P0A6K5
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.