Peptide Deformylase, Recombinant, E. coli, aa2-169, His-SUMO-Tag (Def)

Produktübersicht

• Artikelname: Peptide Deformylase, Recombinant, E. coli, aa2-169, His-SUMO-Tag (Def)
• Artikelnummer: USB-373019
• Hersteller Artikelnummer: 373019
• Alternativnummer: USB-373019-20,USB-373019-200
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions. Source: Recombinant protein corresponding to aa2-169 from E coli Peptide Deformylase, fused to His SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35.2kD Amino Acid Sequence: SVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEEGIGLAATQVDIHQRIIVIDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFELEADGLLAICIQHEMDHLVGKLFMDYLSPLKQQRIRQKVEKLDRLKARA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 35.2
• UniProt: P0A6K3
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.