DEFB126, Recombinant, Pongo Pygmaeus, aa21-63, GST-Tag (Beta-defensin 126, Defensin Beta 126)

Produktübersicht

• Artikelname: DEFB126, Recombinant, Pongo Pygmaeus, aa21-63, GST-Tag (Beta-defensin 126, Defensin Beta 126)
• Artikelnummer: USB-373028
• Hersteller Artikelnummer: 373028
• Alternativnummer: USB-373028-10,USB-373028-50,USB-373028-100,USB-373028-200
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Has antibacterial activity. Partial recombinant protein corresponding to aa21-63 from pongo pygmaeus DEFB126, fused to GST-Tag at N-terminal, expressed in Yeast. Accession/Uniprot: A4H244 Molecular Weight: ~32.31kD Amino Acid Sequence: SWYVKKCLNDVGICKKKCKPEELHVKNGWAMCGKQRDCCVPAD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 32.31
• UniProt: A4H244
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.