DERF2, Recombinant, Dermatophagoides farinae, aa18-146, His-Tag (Mite Group 2 Allergen Der f 2)

Artikelnummer: USB-373038
Artikelname: DERF2, Recombinant, Dermatophagoides farinae, aa18-146, His-Tag (Mite Group 2 Allergen Der f 2)
Artikelnummer: USB-373038
Hersteller Artikelnummer: 373038
Alternativnummer: USB-373038-20,USB-373038-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa18-146 from dermatophagoides farinae Mite Group 2 Allergen Der f 2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.1kD Amino Acid Sequence: DQVDVKDCANNEIKKVMVDGCHGSDPCIIHRGKPFTLEALFDANQNTKTAKIEIKASLDGLEIDVPGIDTNACHFMKCPLVKGQQYDIKYTWNVPKIAPKSENVVVTVKLIGDNGVLACAIATHGKIRD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 16.1
UniProt: Q00855
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.