DGKG, Recombinant, Human, aa1-255, His-SUMO-Tag (Diacylglycerol Kinase gamma)

Artikelnummer: USB-373047
Artikelname: DGKG, Recombinant, Human, aa1-255, His-SUMO-Tag (Diacylglycerol Kinase gamma)
Artikelnummer: USB-373047
Hersteller Artikelnummer: 373047
Alternativnummer: USB-373047-20,USB-373047-100,USB-373047-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Reverses the normal flow of glycerolipid biosynthesis by phosphorylating diacylglycerol back to phosphatidic acid. Source: Recombinant protein corresponding to aa1-255 from human DGKG, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~44.9kD Amino Acid Sequence: MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMRAYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGMTTIPL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 44.9
UniProt: P49619
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.