DKK2, Recombinant, Human, aa34-259, His-SUMO-Tag (Dickkopf-related Protein 2)

Artikelnummer: USB-373063
Artikelname: DKK2, Recombinant, Human, aa34-259, His-SUMO-Tag (Dickkopf-related Protein 2)
Artikelnummer: USB-373063
Hersteller Artikelnummer: 373063
Alternativnummer: USB-373063-20,USB-373063-100,USB-373063-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease. Source: Recombinant protein corresponding to aa34-259 from human DKK2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~41.0kD Amino Acid Sequence: KLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 41
UniProt: Q9UBU2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.