DNAJC19, Recombinant, Human, aa1-116, GST-Tag (Mitochondrial Import Inner Membrane Translocase Subunit TIM14)

Produktübersicht

• Artikelname: DNAJC19, Recombinant, Human, aa1-116, GST-Tag (Mitochondrial Import Inner Membrane Translocase Subunit TIM14)
• Artikelnummer: USB-373081
• Hersteller Artikelnummer: 373081
• Alternativnummer: USB-373081-20,USB-373081-100,USB-373081-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity. Source: Recombinant protein corresponding to aa1-116 from human DNAJC19, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.4kD Amino Acid Sequence: ASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 39.4
• UniProt: Q96DA6
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.