DRB5, Recombinant, Arabidopsis thaliana, aa1-393, His-Tag (Double-stranded RNA-binding Protein 5)

Produktübersicht

• Artikelname: DRB5, Recombinant, Arabidopsis thaliana, aa1-393, His-Tag (Double-stranded RNA-binding Protein 5)
• Artikelnummer: USB-373098
• Hersteller Artikelnummer: 373098
• Alternativnummer: USB-373098-20,USB-373098-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Binds double-stranded RNA. May be involved in RNA-mediated silencing. Source: Recombinant protein corresponding to aa1-393 from arabidopsis thaliana DRB5, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~45.6kD Amino Acid Sequence: MYKNQLQELAQRSCFNLPSYTCIREGPDHAPRFKASVNFNGEIFESPTYCSTLRQAEHAAAEVSLNVLSSRVPSKSLTAKILDETGIYKNLLQETAHRAGLDLPMYTSVRSGSCHFPGFSCTVELAGMTFTGESAKTKKQAEKNAAIAAWSSLKKMSSLDSQDEEKEQEAVARVLSRFKPKEVRRRETTNQWRRRTSQQDSNKDLLIERLRWINLLTNQASSSSSTSTPNQHKNSSFISLIPPPPPPKSSKILPFIQQYKDRSSQEAKTETATEMINSKAKVNETSTRLSKQMPFSDMNRYNFVGGCSVNPYSLAPAVQMRSVIPVFAAPPPKPNPNLNPSSLSSSVNEFTSSNNSCSVLNTPGLGGQEKKNLTREMIKLGSESRILDQTHDS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 45.6
• UniProt: Q8GY79
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.