DTD2, Recombinant, Human, aa1-168, His-SUMO-Tag (Probable D-tyrosyl-tRNA (Tyr) Deacylase 2)

Produktübersicht

• Artikelname: DTD2, Recombinant, Human, aa1-168, His-SUMO-Tag (Probable D-tyrosyl-tRNA (Tyr) Deacylase 2)
• Artikelnummer: USB-373104
• Hersteller Artikelnummer: 373104
• Alternativnummer: USB-373104-20,USB-373104-100,USB-373104-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr). Could be a defense mechanism against a harmful effect of D-tyrosine (Potential). Curated. Source: Recombinant protein corresponding to aa1-168 from human DTD2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.7kD Amino Acid Sequence: MAEGSRIPQARALLQQCLHARLQIRPADGDVAAQWVEVQRGLVIYVCFFKGADKELLPKMVNTLLNVKLSETENGKHVSILDLPGNILIIPQATLGGRLKGRNMQYHSNSGKEEGFELYSQFVTLCEKEVAANSKCAEARVVVEHGTYGNRQVLKLDTNGPFTHLIEF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 34.7
• UniProt: Q96FN9
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.