DUSP14, Recombinant, Human, aa1-198, His-SUMO-Tag (Dual Specificity Protein Phosphatase 14)

Produktübersicht

• Artikelname: DUSP14, Recombinant, Human, aa1-198, His-SUMO-Tag (Dual Specificity Protein Phosphatase 14)
• Artikelnummer: USB-373108
• Hersteller Artikelnummer: 373108
• Alternativnummer: USB-373108-20,USB-373108-100,USB-373108-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Involved in the inactivation of MAP kinases. Dephosphorylates ERK, JNK and p38 MAP-kinases. Source: Recombinant protein corresponding to aa1-198 from human DUSP14, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.3kD Amino Acid Sequence: MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 38.3
• UniProt: O95147
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.