DYDC2, Recombinant, Human, aa1-177, His-SUMO-Tag (DPY30 Domain-containing Protein 2)

Produktübersicht

• Artikelname: DYDC2, Recombinant, Human, aa1-177, His-SUMO-Tag (DPY30 Domain-containing Protein 2)
• Artikelnummer: USB-373111
• Hersteller Artikelnummer: 373111
• Alternativnummer: USB-373111-20,USB-373111-100,USB-373111-1
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Source: Recombinant protein corresponding to aa1-177 from human DYDC2, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.6kD Amino Acid Sequence: METNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEEYDSSLKEMEMTEMLKQEEYQIQQNCEKCHKELTSETVSTKKTIFMQEDTNPLEKEALKQEFLPGTSSLIPGMPQQVPPSESAGQIDQNFKMPQEINYKEAFQHEVAHEMPPGSKSPF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 36.6
• UniProt: Q96IM9
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.