EEF1B2, Recombinant, Human, aa1-225, GST-Tag (Elongation Factor 1-beta)

Artikelnummer: USB-373128
Artikelname: EEF1B2, Recombinant, Human, aa1-225, GST-Tag (Elongation Factor 1-beta)
Artikelnummer: USB-373128
Hersteller Artikelnummer: 373128
Alternativnummer: USB-373128-20,USB-373128-100,USB-373128-1
Hersteller: US Biological
Kategorie: Molekularbiologie
EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP. Source: Recombinant protein corresponding to aa1-225 from human EEF1B2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~51.6kD Amino Acid Sequence: GFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 51.6
UniProt: P24534
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.