Enhanced Green Fluorescent Protein, Recombinant, Human Cytomegalovirus, aa1-239, His-Tag, Myc-Tag (EGFP)

Artikelnummer: USB-373144
Artikelname: Enhanced Green Fluorescent Protein, Recombinant, Human Cytomegalovirus, aa1-239, His-Tag, Myc-Tag (EGFP)
Artikelnummer: USB-373144
Hersteller Artikelnummer: 373144
Alternativnummer: USB-373144-20,USB-373144-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Full length recombinant protein corresponding to aa1-239 from human cytomegalovirus Enhanced Green Fluorescent Protein, fused to 10X His-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Yeast. Accession/Uniprot: C5MKY7 Molecular Weight: ~30.9kD Amino Acid Sequence: MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 30.9
UniProt: C5MKY7
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.