EGR1, Recombinant, Human, aa444-543, His-Tag (Early Growth Response Protein 1)

Produktübersicht

• Artikelname: EGR1, Recombinant, Human, aa444-543, His-Tag (Early Growth Response Protein 1)
• Artikelnummer: USB-373147
• Hersteller Artikelnummer: 373147
• Alternativnummer: USB-373147-20,USB-373147-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Transcriptional regulator. Recognizes and binds to the DNA sequence 5-CGCCCCCGC-3(EGR-site). Activates the transcription of target genes whose products are required for mitogenesis and differentiation. Source: Recombinant protein corresponding to aa444-543 from human EGR1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.1kD Amino Acid Sequence: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 12.1
• UniProt: P18146
• Reinheit: 85% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.