EIF2B1, Recombinant, Human, aa1-305, GST-Tag (Translation Initiation Factor eIF-2B Subunit alpha)

Artikelnummer: USB-373153
Artikelname: EIF2B1, Recombinant, Human, aa1-305, GST-Tag (Translation Initiation Factor eIF-2B Subunit alpha)
Artikelnummer: USB-373153
Hersteller Artikelnummer: 373153
Alternativnummer: USB-373153-20,USB-373153-100,USB-373153-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Source: Recombinant protein corresponding to aa1-305 from human EIF2B1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~60.7kD Amino Acid Sequence: MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDELIKLYL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 60.7
UniProt: Q14232
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.