EntB, Recombinant, Staphylococcus Aureus, aa28-266, GST-Tag (Enterotoxin Type B, SEB)

Produktübersicht

• Artikelname: EntB, Recombinant, Staphylococcus Aureus, aa28-266, GST-Tag (Enterotoxin Type B, SEB)
• Artikelnummer: USB-373188
• Hersteller Artikelnummer: 373188
• Alternativnummer: USB-373188-20, USB-373188-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Source: Recombinant protein corresponding to aa28-266 from staphylococcus aureus EntB, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~55.4kD Amino Acid Sequence: ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 55.4
• UniProt: P01552
• Reinheit: ~90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.