EntG, Recombinant, Staphylococcus Aureus, aa26-258, His-SUMO-Tag (Enterotoxin Type G)

Produktübersicht

• Artikelname: EntG, Recombinant, Staphylococcus Aureus, aa26-258, His-SUMO-Tag (Enterotoxin Type G)
• Artikelnummer: USB-373196
• Hersteller Artikelnummer: 373196
• Alternativnummer: USB-373196-20, USB-373196-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Staphylococcal enterotoxins cause the intoxication staphylococcal food poisoning syndrome. The illness is characterized by high fever, hypotension, diarrhea, shock, and in some cases death. Source: Recombinant protein corresponding to aa26-258 from staphylococcus aureus EntG, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.0kD Amino Acid Sequence: QPDPKLDELNKVSDYKNNKGTMGNVMNLYTSPPVEGRGVINSRQFLSHDLIFPIEYKSYNEVKTELENTELANNYKDKKVDIFGVPYFYTCIIPKSEPDINQNFGGCCMYGGLTFNSSENERDKLITVQVTIDNRQSLGFTITTNKNMVTIQELDYKARHWLTKEKKLYEFDGSAFESGYIKFTEKNNTSFWFDLFPKKELVPFVPYKFLNIYGDNKVVDSKSIKMEVFLNTH Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 43
• UniProt: P0A0L6
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.