Envelope Glycoprotein L, Recombinant, Epstein-Barr Virus, aa23-137, His-SUMO-Tag (gL)

Artikelnummer: USB-373199
Artikelname: Envelope Glycoprotein L, Recombinant, Epstein-Barr Virus, aa23-137, His-SUMO-Tag (gL)
Artikelnummer: USB-373199
Hersteller Artikelnummer: 373199
Alternativnummer: USB-373199-20, USB-373199-100
Hersteller: US Biological
Kategorie: Molekularbiologie
The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma membranes leading to virus entry into the host cell. Membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. Fusion of EBV with B-lymphocytes requires the additional receptor-binding protein gp42, which forms a complex with gH/gL. May also be required for virus attachment to epithelial cells. Source: Recombinant protein corresponding to aa23-137 from epstein-barr virus gL, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~28.7kD Amino Acid Sequence: NWAYPCCHVTQLRAQHLLALENISDIYLVSNQTCDGFSLASLNSPKNGSNQLVISRCANGLNVVSFFISILKRSSSALTGHLRELLTTLETLYGSFSVEDLFGANLNRYAWHRGG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.7
UniProt: P03212
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.