Epiplakin, Recombinant, Human, aa1-225, His-Tag (EPPK1)

Artikelnummer: USB-373204
Artikelname: Epiplakin, Recombinant, Human, aa1-225, His-Tag (EPPK1)
Artikelnummer: USB-373204
Hersteller Artikelnummer: 373204
Alternativnummer: USB-373204-20, USB-373204-100, USB-373204-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-225 from human Epiplakin, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.5kD Amino Acid Sequence: MSGHTLPPLPVPGTNSTEQASVPRAMAATLGAGTPPRPQARSIAGVYVEASGQAQSVYAAMEQGLLPAGLGQALLEAQAATGGLVDLARGQLLPVSKALQQGLVGLELKEKLLAAERATTGYPDPYGGEKLALFQAIGKEVVDRALGQSWLEVQLATGGLVDPAQGVLVAPEPACHQGLLDRETWHKLSELEPGTGDLRFLNPNTLERLTYHQLLERCVRAPGSG Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. ility.
Molekulargewicht: 27.5
UniProt: P58107
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.