Erythropoietin, Recombinant, Macaca Fascicularis, aa28-192, His-SUMO-Tag (EPO)

Artikelnummer: USB-373206
Artikelname: Erythropoietin, Recombinant, Macaca Fascicularis, aa28-192, His-SUMO-Tag (EPO)
Artikelnummer: USB-373206
Hersteller Artikelnummer: 373206
Alternativnummer: USB-373206-20, USB-373206-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Erythropoietin is the principal hormone involved in the regulation of erythrocyte differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Source: Recombinant protein corresponding to aa28-192 from macaca fascicularis Erythropoietin, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~34.2kD Amino Acid Sequence: APPRLICDSRVLERYLLEAKEAENVTMGCSESCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQAVLANSSQPFEPLQLHMDKAISGLRSITTLLRALGAQEAISLPDAASAAPLRTITADTFCKLFRVYSNFLRGKLKLYTGEACRRGDR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 34.2
UniProt: P07865
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.