ERGIC3, Recombinant, Human, aa47-341, His-SUMO-Tag (Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 3)

Artikelnummer: USB-373216
Artikelname: ERGIC3, Recombinant, Human, aa47-341, His-SUMO-Tag (Endoplasmic Reticulum-Golgi Intermediate Compartment Protein 3)
Artikelnummer: USB-373216
Hersteller Artikelnummer: 373216
Alternativnummer: USB-373216-20,USB-373216-100,USB-373216-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Possible role in transport between endoplasmic reticulum and Golgi. Source: Recombinant protein corresponding to aa47-341 from human ERGIC3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49.7kD Amino Acid Sequence: QYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKQRLDKDGIPVSSEAERHELGKVEVTVFDPDSLDPDRCESCYGAEAEDIKCCNTCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSFQQSHVHVHDLQSFGLDNINMTHYIQHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSF Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 49.7
UniProt: Q9Y282
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.