ERH, Recombinant, Human, aa2-104, GST-Tag (Enhancer of Rudimentary Homolog)

Artikelnummer: USB-373217
Artikelname: ERH, Recombinant, Human, aa2-104, GST-Tag (Enhancer of Rudimentary Homolog)
Artikelnummer: USB-373217
Hersteller Artikelnummer: 373217
Alternativnummer: USB-373217-20,USB-373217-100,USB-373217-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May have a role in the cell cycle. Source: Recombinant protein corresponding to aa2-104 from human ERH, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.1kD Amino Acid Sequence: SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 39.1
UniProt: P84090
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.