FABP5, Recombinant, Human, aa1-135, GST-Tag (Fatty Acid-Binding Protein, Epidermal)

Artikelnummer: USB-373255
Artikelname: FABP5, Recombinant, Human, aa1-135, GST-Tag (Fatty Acid-Binding Protein, Epidermal)
Artikelnummer: USB-373255
Hersteller Artikelnummer: 373255
Alternativnummer: USB-373255-20,USB-373255-100,USB-373255-1
Hersteller: US Biological
Kategorie: Molekularbiologie
High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation. Source: Recombinant protein corresponding to aa1-135 from human FABP5, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.2kD Amino Acid Sequence: MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 42.2
UniProt: Q01469
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.