FCGRT, Recombinant, Macaca Fascicularis, aa24-297, His-SUMO-Tag (IgG Receptor FcRn Large Subunit p51)

Artikelnummer: USB-373300
Artikelname: FCGRT, Recombinant, Macaca Fascicularis, aa24-297, His-SUMO-Tag (IgG Receptor FcRn Large Subunit p51)
Artikelnummer: USB-373300
Hersteller Artikelnummer: 373300
Alternativnummer: USB-373300-20,USB-373300-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Binds to the Fc region of monomeric immunoglobulins gamma. Mediates the uptake of IgG from milk. Possible role in transfer of immunoglobulin G from mother to fetus. Source: Recombinant protein corresponding to aa24-297 from macaca fascicularis FCGRT, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~46.4kD Amino Acid Sequence: AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 46.4
UniProt: Q8SPV9
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.