Fibroblast Growth Factor 1, Recombinant, Human, aa16-155, His-SUMO-Tag (FGF1)

Artikelnummer: USB-373312
Artikelname: Fibroblast Growth Factor 1, Recombinant, Human, aa16-155, His-SUMO-Tag (FGF1)
Artikelnummer: USB-373312
Hersteller Artikelnummer: 373312
Alternativnummer: USB-373312-20,USB-373312-100,USB-373312-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Source: Recombinant protein corresponding to aa16-155 from human Fibroblast Growth Factor 1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~31.8kD Amino Acid Sequence: FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 31.8
UniProt: P05230
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.