FGF10, Recombinant, Human, aa41-208, His-SUMO-Tag (Fibroblast Growth Factor 10)

Artikelnummer: USB-373316
Artikelname: FGF10, Recombinant, Human, aa41-208, His-SUMO-Tag (Fibroblast Growth Factor 10)
Artikelnummer: USB-373316
Hersteller Artikelnummer: 373316
Alternativnummer: USB-373316-20,USB-373316-100,USB-373316-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing. Source: Recombinant protein corresponding to aa41-208 from human FGF10, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~35kD Amino Acid Sequence: GQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35
UniProt: O15520
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.