Fibroblast Growth Factor 23, Recombinant, Rat (Fgf23)

Artikelnummer: USB-373320
Artikelname: Fibroblast Growth Factor 23, Recombinant, Rat (Fgf23)
Artikelnummer: USB-373320
Hersteller Artikelnummer: 373320
Alternativnummer: USB-373320-20, USB-373320-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Regulator of vitamin-D metabolism. Negatively regulates osteoblasts differentiation and matrix mineralization. Acts directly on the parathyroid to decrease PTH secretion. Upregulates EGR1 expression in the presence of KL. Full-length recombinant protein corresponding to aa25-251 from rat FGF23, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.5kD Amino Acid Sequence: YSDTSPLLGSNWGSLTHLYTATARNSYHLQIHRDGHVDGTPHQTIYSALMITSEDAGSVVIIGAMTRRFLCMDLRGNIFGSYHFSPENCRFRQWTLENGYDVYLSPKHHYLVSLGRSKRIFQPGTNPPPFSQFLARRNEVPLLHFYTARPRRHTRSAEDPPERDPLNVLKPRPRATPIPVSCSRELPSAEEGGPAASDPLGVLRRGRGDARRGAGGTDRCRPFPRFV Storage and Stability: May be stored at 4C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20C. Aliquots are stable for 6 months after receipt at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.5
UniProt: Q8VI82
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.