FHL3, Recombinant, Human, aa1-280, GST-Tag (Four and a Half LIM Domains Protein 3)

Artikelnummer: USB-373333
Artikelname: FHL3, Recombinant, Human, aa1-280, GST-Tag (Four and a Half LIM Domains Protein 3)
Artikelnummer: USB-373333
Hersteller Artikelnummer: 373333
Alternativnummer: USB-373333-20,USB-373333-100,USB-373333-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Source: Recombinant protein corresponding to aa1-280 from full length human FHL3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~58.1kD Amino Acid Sequence: SESFDCAKCNESLYGRKYIQTDSGPYCVPCYDNTFANTCAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNDCYCSAFSSQCSACGETVMPGSRKLEYGGQTWHEHCFLCSGCEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKTLTQGGVTYRDQPWHRECLVCTGCQTPLAGQQFTSRDEDPYCVACFGELFAPKCSSCKRPIVGLGGGKYVSFEDRHWHHNCFSCARCSTSLVGQGFVPDGDQVLCQGCSQAGP Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 58.1
UniProt: Q13643
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.