FIBP, Recombinant, Human, aa2-357, His-SUMO-Tag (Acidic Fibroblast Growth Factor Intracellular-binding Protein)

Artikelnummer: USB-373336
Artikelname: FIBP, Recombinant, Human, aa2-357, His-SUMO-Tag (Acidic Fibroblast Growth Factor Intracellular-binding Protein)
Artikelnummer: USB-373336
Hersteller Artikelnummer: 373336
Alternativnummer: USB-373336-20,USB-373336-100,USB-373336-1
Hersteller: US Biological
Kategorie: Molekularbiologie
May be involved in mitogenic function of FGF1. Source: Recombinant protein corresponding to aa2-357 from human FIBP, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~57.1kD Amino Acid Sequence: TSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLLHAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDNFKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNWTLGAVDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFKNLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRYMGTLRGCLLRLYHD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 57.1
UniProt: O43427
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.