GDF11, Recombinant, Human, aa299-407, His-SUMO-Tag (Growth/Differentiation Factor 11)

Artikelnummer: USB-373413
Artikelname: GDF11, Recombinant, Human, aa299-407, His-SUMO-Tag (Growth/Differentiation Factor 11)
Artikelnummer: USB-373413
Hersteller Artikelnummer: 373413
Alternativnummer: USB-373413-20, USB-373413-100, USB-373413-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Secreted signal that acts globally to specify positional identity along the anterior/posterior axis during development. Play critical roles in patterning both mesodermal and neural tissues and in establishing the skeletal pattern. Source: Recombinant protein corresponding to aa299-407 from human GDF11, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~28.5kD Amino Acid Sequence: NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 28.5
UniProt: O95390
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.