GDF5, Recombinant, Mouse, aa376-495, His-Tag (Growth/differentiation Factor 5)

Artikelnummer: USB-373417
Artikelname: GDF5, Recombinant, Mouse, aa376-495, His-Tag (Growth/differentiation Factor 5)
Artikelnummer: USB-373417
Hersteller Artikelnummer: 373417
Alternativnummer: USB-373417-20, USB-373417-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Growth factor involved in bone and cartilage formation. During cartilage development regulates differentiation of chondrogenic tissue through two pathways. Firstly, positively regulates differentiation of chondrogenic tissue through its binding of high affinity with BMPR1B and of less affinity with BMPR1A, leading to induction of SMAD1-SMAD5-SMAD8 complex phosphorylation and then SMAD protein signaling transduction. Secondly, negatively regulates chondrogenic differentiation through its interaction with NOG. Required to prevent excessive muscle loss upon denervation. This function requires SMAD4 and is mediated by phosphorylated SMAD1/5/8. Binds bacterial lipopolysaccharide (LPS) and mediates LPS-induced inflammatory response, including TNF secretion by monocytes. Full length recombinant protein corresponding to aa376-495 from mouse GDF5, fused to 6X His-Tag at N-terminal, expressed in E. coli. Swiss/Uniprot: P43027 Molecular Weight: ~17.6kD Amino Acid Sequence: APLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 17.6
UniProt: P43027
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.