GLI2, Recombinant, Human, aa412-641, His-Tag (Zinc Finger Protein GLI2)

Produktübersicht

• Artikelname: GLI2, Recombinant, Human, aa412-641, His-Tag (Zinc Finger Protein GLI2)
• Artikelnummer: USB-373446
• Hersteller Artikelnummer: 373446
• Alternativnummer: USB-373446-20,USB-373446-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

Functions as transcription regulator in the hedgehog (Hh) pathway (PubMed:18455992). Functions as transcriptional activator (PubMed:9557682, PubMed:19878745, PubMed:24311597). May also function as transcriptional repressor (By similarity). Requires STK36 for full transcriptional activator activity. Required for normal embryonic development (PubMed:15994174, PubMed:20685856). Source: Recombinant protein corresponding to aa412-641 from human GLI2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~28.5kD Amino Acid Sequence: EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 28.5
• UniProt: P10070
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.