GLRX2, Mitochondrial, Recombinant, Human, aa1-124, GST-Tag (Glutaredoxin-2)

Artikelnummer: USB-373456
Artikelname: GLRX2, Mitochondrial, Recombinant, Human, aa1-124, GST-Tag (Glutaredoxin-2)
Artikelnummer: USB-373456
Hersteller Artikelnummer: 373456
Alternativnummer: USB-373456-20, USB-373456-100, USB-373456-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Glutathione-dependent oxidoreductase that facilitates the maintenance of mitochondrial redox homeostasis upon induction of apoptosis by oxidative stress. Involved in response to hydrogen peroxide and regulation of apoptosis caused by oxidative stress. Acts as a very efficient catalyst of monothiol reactions because of its high affinity for protein glutathione-mixed disulfides. Can receive electrons not only from glutathione (GSH), but also from thioredoxin reductase supporting both monothiol and dithiol reactions. Efficiently catalyzes both glutathionylation and deglutathionylation of mitochondrial complex I, which in turn regulates the superoxide production by the complex. Overexpression decreases the susceptibility to apoptosis and prevents loss of cardiolipin and cytochrome c release. Source: Recombinant protein corresponding to aa1-124 from human GLRX2, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~41.1kD Amino Acid Sequence: MESNTSSSLENLATAPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYLKKSKRKEFQ Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 41.1
UniProt: Q9NS18
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.