GM2S-1, Recombinant, Glycine Max, aa22-158, HIs-SUMO-Tag (2S Albumin)

Produktübersicht

• Artikelname: GM2S-1, Recombinant, Glycine Max, aa22-158, HIs-SUMO-Tag (2S Albumin)
• Artikelnummer: USB-373479
• Hersteller Artikelnummer: 373479
• Alternativnummer: USB-373479-20, USB-373479-100
• Hersteller: US Biological
• Kategorie: Molekularbiologie

Produktbeschreibung

This is a 2S seed storage protein. Source: Recombinant protein corresponding to aa22-158 from glycine max 2S Albumin, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~32.2kD Amino Acid Sequence: SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Produkteigenschaften

• Molekulargewicht: 32.2
• UniProt: P19594
• Reinheit: 90% (SDS-PAGE)
• Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.