GOLM1, Recombinant, Human, aa36-401, His-Tag (Golgi Membrane Protein 1)

Artikelnummer: USB-373497
Artikelname: GOLM1, Recombinant, Human, aa36-401, His-Tag (Golgi Membrane Protein 1)
Artikelnummer: USB-373497
Hersteller Artikelnummer: 373497
Alternativnummer: USB-373497-20, USB-373497-100, USB-373497-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Unknown. Cellular response protein to viral infection. Source: Partial recombinant protein corresponding to aa36-401 from human GOLM1, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.6kD Amino Acid Sequence: SSRSVDLQTRIMELEGRVRRAAAERGAVELKKNEFQGELEKQREQLDKIQSSHNFQLESVNKLYQDEKAVLVNNITTGERLIRVLQDQLKTLQRNYGRLQQDVLQFQKNQTNLERKFSYDLSQCINQMKEVKEQCEERIEEVTKKGNEAVASRDLSENNDQRQQLQALSEPQPRLQAAGLPHTEVPQGKGNVLGNSKSQTPAPSSEVVLDSKRQVEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDYNMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 45.6
UniProt: Q8NBJ4
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.