GP25L2, Recombinant, Human, aa40-197, GST-Tag (Transmembrane Emp24 Domain-containing Protein 9)

Artikelnummer: USB-373505
Artikelname: GP25L2, Recombinant, Human, aa40-197, GST-Tag (Transmembrane Emp24 Domain-containing Protein 9)
Artikelnummer: USB-373505
Hersteller Artikelnummer: 373505
Alternativnummer: USB-373505-20,USB-373505-100,USB-373505-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway. In COPI vesicle-mediated retrograde transport involved in the coatomer recruitment to membranes of the early secretory pathway. Increases coatomer-dependent activity of ARFGAP2. Thought to play a crucial role in the specific retention of p24 complexes in cis-Golgi membranes, specifically contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network. May be involved in organization of intracellular membranes, such as of the ER-Golgi intermediate compartment and the Golgi apparatus. Involved in ER localization of PTPN2 isoform PTPB. Source: Recombinant protein corresponding to aa40-197 from human GP25L2, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~45.5kD Amino Acid Sequence: FHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 45.5
UniProt: Q9BVK6
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.