GPX1, Recombinant, Human, aa1-203, His-Tag (Glutathione Peroxidase 1)

Artikelnummer: USB-373519
Artikelname: GPX1, Recombinant, Human, aa1-203, His-Tag (Glutathione Peroxidase 1)
Artikelnummer: USB-373519
Hersteller Artikelnummer: 373519
Alternativnummer: USB-373519-20, USB-373519-100, USB-373519-1
Hersteller: US Biological
Kategorie: Molekularbiologie
Protects the hoglobin in erythrocytes from oxidative breakdown. Source: Recombinant protein corresponding to aa1-203 from human Glutathione Peroxidase 1, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.1kD Amino Acid Sequence: MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTVRDYTQMNELQRRLGPRGLVVLGFPCNQFGHQENAKNEEILNSLKYVRPGGGFEPNFMLFEKCEVNGAGAHPLFAFLREALPAPSDDATALMTDPKLITWSPVCRNDVAWNFEKFLVGPDGVPLRRYSRRFQTIDIEPDIEALLSQGPSCA Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 26.1
UniProt: P07203
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.