GPX4, Recombinant, Pongo pygmaeus, aa1-170, His-SUMO-Tag (Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial)

Artikelnummer: USB-373520
Artikelname: GPX4, Recombinant, Pongo pygmaeus, aa1-170, His-SUMO-Tag (Phospholipid Hydroperoxide Glutathione Peroxidase, Mitochondrial)
Artikelnummer: USB-373520
Hersteller Artikelnummer: 373520
Alternativnummer: USB-373520-20,USB-373520-100
Hersteller: US Biological
Kategorie: Molekularbiologie
Could play a major role in protecting mammals from the toxicity of ingested lipid hydroperoxides. Essential for embryonic development. Protects from radiation and oxidative damage. Source: Recombinant protein corresponding to aa1-170 from pongo pygmaeus GPX4, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~35.0kD Amino Acid Sequence: MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLI Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 35
UniProt: Q4AEH2
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.