GPX5, Recombinant, Porcine, aa22-219, His-Tag, Myc-Tag (Epididymal Secretory Glutathione Peroxidase)

Artikelnummer: USB-373522
Artikelname: GPX5, Recombinant, Porcine, aa22-219, His-Tag, Myc-Tag (Epididymal Secretory Glutathione Peroxidase)
Artikelnummer: USB-373522
Hersteller Artikelnummer: 373522
Alternativnummer: USB-373522-20, USB-373522-100
Hersteller: US Biological
Kategorie: Molekularbiologie
May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids. Since the purified porcine enzyme has very little activity towards hydrogen peroxide or organic hydroperoxides the protective effect is not likely to be exerted by its enzymatic activity. Instead, may protect sperm from premature acrosome reaction in the epididymis by binding to lipid peroxides, which might otherwise interact with phospholipase A2 and induce the acrosome reaction. Source: Recombinant protein corresponding to aa22-219 from porcine GPX5, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~27.6kD Amino Acid Sequence: NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE Storage and Stability: Lyophilized and reconstituted products are stable for 6 months after receipt at -20C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Molekulargewicht: 27.6
UniProt: O18994
Reinheit: 90% (SDS-PAGE)
Formulierung: Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.